PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A09G1525
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 285aa    MW: 32006.8 Da    PI: 8.6305
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A09G1525genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.33e-072974346
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                     +WT +E +++ +a +++      +W  +a++++ g+t  +++  ++ 
      Gh_A09G1525 29 KWTHQENKRFENALALYDQQtpdRWFNVAAMIP-GKTVADVIKQYRE 74
                     7*****************99*************.*******999986 PP

2Myb_DNA-binding43.57.6e-14127171347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+ E+ +++ + +++G+g+W++I+r + ++Rt+ q+ s+ qky
      Gh_A09G1525 127 PWTENEHRQFLMGLRKYGKGDWRSISRNFVTTRTPTQVASHAQKY 171
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512938.2482580IPR017884SANT domain
SMARTSM007171.1E-62678IPR001005SANT/Myb domain
CDDcd001671.30E-62975No hitNo description
PfamPF002496.0E-62974IPR001005SANT/Myb domain
SuperFamilySSF466893.59E-102982IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.2E-12117175IPR009057Homeodomain-like
PROSITE profilePS5129418.795120176IPR017930Myb domain
SuperFamilySSF466891.36E-16121175IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-17123175IPR006447Myb domain, plants
SMARTSM007174.2E-11124174IPR001005SANT/Myb domain
CDDcd001673.58E-9127172No hitNo description
PfamPF002491.8E-11127171IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MMNRGFEILS PPSYSHASNW LFQESKDIKW THQENKRFEN ALALYDQQTP DRWFNVAAMI  60
PGKTVADVIK QYRELEEDVS DIEAGLIPIP GYLTDSFTFN WVNNHTPGGK TGTGTPPCDQ  120
ERKKGVPWTE NEHRQFLMGL RKYGKGDWRS ISRNFVTTRT PTQVASHAQK YFIRQLTGGK  180
DKRRSSIHDI TTLNIADTPS SSPDHGKPSS PKNASAVAGV TNEVLFDFEW NLQKEGAAIV  240
FDQRSSGNAL LSPFCKVPSY GPKLDEQNLA SGTFPTSQFG PYRGM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A1e-1630941175RADIALIS
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012486204.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H71e-93DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0D2NUG80.0A0A0D2NUG8_G
STRINGPOPTR_0016s11980.11e-137(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122827100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.11e-107MYB family protein